PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10039646
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 359aa    MW: 40412.1 Da    PI: 6.5984
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10039646genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ ++ q+G+g +W + ++++g++R++k+c++rw++yl
      Lus10039646 14 KGPWSPEEDARLKSYIDQHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding33.41e-1070111346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++ +Ed ++  +    G++ W+ Ia+ ++ gRt++++k++w++
      Lus10039646  70 GFSDQEDHIICSLYLSIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      699*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.65966IPR017930Myb domain
SuperFamilySSF466891.96E-2511109IPR009057Homeodomain-like
SMARTSM007179.2E-121364IPR001005SANT/Myb domain
PfamPF002492.5E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-241569IPR009057Homeodomain-like
CDDcd001676.12E-91662No hitNo description
SMARTSM007174.4E-867115IPR001005SANT/Myb domain
PROSITE profilePS5129415.08167117IPR017930Myb domain
PfamPF002492.2E-969111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2270117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDARLKSYID QHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNLKHGG FSDQEDHIIC SLYLSIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGS  120
KHHRKSNDHS ARRTNNTFLK HSDTPPPMLP PPDHHDHMMM MDHHQQEIAA AAHQYWLPGS  180
MMPPLPPDML VKLQGSAGNL VFHNINDNEY DQNQYNNQQQ LQAMMGNSTS TTSRSPNSSV  240
SMDSSFANAS SSLSSILLFQ DQGSFPAELG MENDDNDDQL AVVHNPLELE DDLQNWYVYD  300
QQMGDGSSSS ERTGKNVNPM VGYYDPLLQH LVSDNYSTEI HAFLPPLEHS TIYFSPPQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-23141177108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.16e-79myb domain protein 84